PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA019110-PA
Common NameOsI_18298
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 297aa    MW: 33141.6 Da    PI: 9.2967
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA019110-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix643.4e-202185165
          trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkik 65
                      rW++ e+ a +++r ++++++ ++k++k+lWe+ s+++++ gf r+p qCk+kw+nl +r+k ++
  BGIOSGA019110-PA 21 RWSHAETAAFLAIRADLDHSFLSTKRNKALWEAASARLHALGFARTPDQCKSKWKNLVTRFKGTE 85
                      8*************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.1431478IPR017877Myb-like domain
PfamPF138375.1E-152084No hitNo description
CDDcd122039.42E-192485No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MRGRRCSPTH RRRSSGSASR RWSHAETAAF LAIRADLDHS FLSTKRNKAL WEAASARLHA  60
LGFARTPDQC KSKWKNLVTR FKGTEGAAAV AAAGTDQMQG GQVGGAAARG SSSSFPFHDE  120
LRRIFDARVE RARALERKKV KGKDPDDDHD GGGDGDEDDE EEADQQVDEE DDGASGDTTR  180
AGSKKRRRKA AAAARRTGST GGVEGEVEAM LREFMRRQIE MEERWMEAAE AREAERRARE  240
EEWRTAMVAL GEERLALVRR WREREDAWRA RAEEREERRH QLVAALLAKL GAGDASA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1183188KKRRRK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166404130.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126130.0CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637590.10.0PREDICTED: trihelix transcription factor GT-3b
RefseqXP_015637591.10.0PREDICTED: trihelix transcription factor GT-3b
TrEMBLA2XZZ10.0A2XZZ1_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA019110-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125953134
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.11e-21Trihelix family protein